PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc11g008000.1.1
Common NameLOC101261771
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 529aa    MW: 59472.9 Da    PI: 4.5091
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc11g008000.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.23.9e-54101381128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         l+pGfrFhPtdeelv +yL++k+ g++++  + i+e+diykvePwdLp  +++k+++ ewyfFs  dkky +g r+nrat++gyWk+tgkd
  Solyc11g008000.1.1  10 LAPGFRFHPTDEELVRYYLRRKIYGRTFKS-DLISEIDIYKVEPWDLPgmSRLKTRDLEWYFFSVLDKKYGNGARTNRATEKGYWKTTGKD 99 
                         579*************************99.99***************6347788888********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++v+++k+++vg+kktLv+++grapkg++t+Wvmheyrl
  Solyc11g008000.1.1 100 RAVHRNKSQVVGMKKTLVYHSGRAPKGQRTNWVMHEYRL 138
                         *************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.75E-629161IPR003441NAC domain
PROSITE profilePS5100559.06310161IPR003441NAC domain
PfamPF023657.5E-2812138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009819Biological Processdrought recovery
GO:0010150Biological Processleaf senescence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0005886Cellular Componentplasma membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 529 aa     Download sequence    Send to blast
MESRGSSKLL APGFRFHPTD EELVRYYLRR KIYGRTFKSD LISEIDIYKV EPWDLPGMSR  60
LKTRDLEWYF FSVLDKKYGN GARTNRATEK GYWKTTGKDR AVHRNKSQVV GMKKTLVYHS  120
GRAPKGQRTN WVMHEYRLID EALDKAGIPQ DAFVLCRVFQ KSGAGPKNGE QYGAPFIEEE  180
WEDDELQVPS KDETTEDFVF GDDIYFDANE LDQILGTDKA VAGASFPSDY SYGENGSTEE  240
TNNSSDAQQP DELKPIDLAV QKNFNAEQVN HEYIGESSKN MNSEDGDYLL NEPIVNGTDD  300
LQFNDEAFLE ANDLSNPVQA DSSGFDMLEE YLTYFDANDD FQNMSFDPSV FFGNDDQISD  360
QALLPQKDVG EVTQQPIAPN EGFSEDKNGI ASSSKLVPTK FESDYQYPFI KQASQMLGNI  420
HAPPAFASEF PTKDAILRLN SFSRSASSVQ VTAGNGTRWP LGKHVYYNII LSLGLSRGSS  480
DDSSMDSFHK IHPGKTTSTI SRGWFCYLFF SFLMLLMSLR IGTIICAS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-471016717171NO APICAL MERISTEM PROTEIN
1ut4_B4e-471016717171NO APICAL MERISTEM PROTEIN
1ut7_A4e-471016717171NO APICAL MERISTEM PROTEIN
1ut7_B4e-471016717171NO APICAL MERISTEM PROTEIN
3swm_A4e-471016720174NAC domain-containing protein 19
3swm_B4e-471016720174NAC domain-containing protein 19
3swm_C4e-471016720174NAC domain-containing protein 19
3swm_D4e-471016720174NAC domain-containing protein 19
3swp_A4e-471016720174NAC domain-containing protein 19
3swp_B4e-471016720174NAC domain-containing protein 19
3swp_C4e-471016720174NAC domain-containing protein 19
3swp_D4e-471016720174NAC domain-containing protein 19
4dul_A4e-471016717171NAC domain-containing protein 19
4dul_B4e-471016717171NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.53450.0callus| fruit| leaf| trichome
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00343DAPTransfer from AT3G10500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0137470.0Lycopersicon esculentum clone 132610F, mRNA sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004250028.10.0PREDICTED: NAC domain-containing protein 78
SwissprotQ949N01e-137NAC53_ARATH; NAC domain-containing protein 53
TrEMBLK4D5610.0K4D561_SOLLC; Uncharacterized protein
STRINGSolyc11g008000.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31412450
Representative plantOGRP1057159
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.11e-131NAC domain containing protein 2
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]